PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do007936.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 649aa    MW: 72274.4 Da    PI: 5.9772
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do007936.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.8e-094084451954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  Do007936.1 408 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 445
                 665559******************************88 PP

2BELL119.61.5e-38271342172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 e+qelq+k akL+ +l+eVd++Yk+y++q+q v+ssF++vag g+akpYt++Al++iSrhFrcLkdai +qi
  Do007936.1 271 EKQELQNKMAKLMAMLDEVDRKYKHYYHQMQSVVSSFDVVAGPGAAKPYTAVALQTISRHFRCLKDAINDQI 342
                 689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.1E-58195340IPR006563POX domain
PfamPF075261.3E-51201338IPR006563POX domain
PROSITE profilePS5007112.325386449IPR001356Homeobox domain
CDDcd000864.17E-12389450No hitNo description
SMARTSM003893.6E-9389453IPR001356Homeobox domain
SuperFamilySSF466892.82E-17390455IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-28392455IPR009057Homeodomain-like
PfamPF059201.0E-17406445IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MMATYYSSPG SERDSQNMYS RDPGNASYPM PSALGNLLYL NNSTSGLYTE FSGILQSQQN  60
CMEMPDPGHP SVMSHDSSGR ETDMLGSHQG QRSFGPVKDM KNEMLMHMMD GSQSSTADLI  120
HDDAHNGAQL DFGVLNNHSS SNIPSVQGQG LSLSLNTQIL APSLPYWSVK PDMLSPHSYH  180
DSLRVDDIRM KSMQSEASRA IRNSRYLKAA QELLDEVVNV WKNIKQKAQK EQVEAGNTDG  240
KETEGGAKSE GVSSNPQESA TNAAPELSTA EKQELQNKMA KLMAMLDEVD RKYKHYYHQM  300
QSVVSSFDVV AGPGAAKPYT AVALQTISRH FRCLKDAIND QINVIRKKLG EEENSSGKEG  360
KLTRLRYIDQ QLRQQRAFQQ YGMIPQNAWR PQRGLPENSV TILRAWLFEH FLHPYPKDSE  420
KLMLARQTGL TRSQISNWFI NARVRLWKPM IEDMYKEEIG DIEQDSNSSS DNAPRSKGKM  480
ASSEDKEDLK SSTPRVCESS QLSESRASIG TMNIGGAPVG FQNEPNPDDS FMNLMLKDQR  540
SNEEDGGLLL HNAVAHHQDE NARFMAYHLA ELGRYGNGNV SLTLGLQHSS SNLSVPNAQQ  600
SFHGVGDDGI YNTTAPLGVS VASSDYESMN QMDQRQRFEQ SPLLHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A3e-16395452158Homeobox protein Meis1
4xrs_B3e-16395452158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004963321.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963320.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004963319.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLK3Z4G80.0K3Z4G8_SETIT; Uncharacterized protein
STRINGSi021436m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-112BEL1-like homeodomain 6